PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00017462-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family BBR-BPC
Protein Properties Length: 298aa    MW: 33544.1 Da    PI: 9.5759
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00017462-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind325.51.6e-991329812301
              GAGA_bind  12 gyyepa..aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvenslasalpv 97 
                            ++y+ +  ++++  ++ +l+ + +erd++irer+ al+ekk+a+ erd a +q d+a+ er++a  erdn+++al+++e +   +++ 
  SMil_00017462-RA_Salv  13 PQYQIKepNAFQ--MNAKLVMLCNERDDAIRERDRALTEKKSALDERDAAMKQLDAAIMERDDAQRERDNAIAALQFHEST---VNAL 95 
                            466633246676..99*************************************************************9997...4555 PP

              GAGA_bind  98 gvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesade 185
                             +++ +g+k +++  + ++p+  +sa+ +ree + +alp+++ ++ea  +kk  + +++k+p+ + a+++kk + k  ++ +++ + +
  SMil_00017462-RA_Salv  96 LSGSARGSKRTHHPTN-HHPNSMQSAQSMREECIHDALPVSHVPHEAPLSKKGTRAKTNKDPQMRSARSPKKVK-KIGEDLNRQVTTD 181
                            6899999*99998887.899999999999*************99999999999999999999999999888854.5556777777678 PP

              GAGA_bind 186 rskaekksidl.vlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekL 272
                             skae++ +dl ++n++ +Des++PvPvCsCtG++rqCYkWGnGGWqS+CCtt++S yPLP+++++r+aR++grKmS+++f++lL +L
  SMil_00017462-RA_Salv 182 GSKAEWDAQDLgSMNQIMFDESSMPVPVCSCTGVPRQCYKWGNGGWQSSCCTTSLSLYPLPQMPNKRHARMGGRKMSGSVFSRLLTRL 269
                            8**********88*************************************************************************** PP

              GAGA_bind 273 aaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                            aa G dls pvDLk++WAkHGtn+++ti+
  SMil_00017462-RA_Salv 270 AAAGQDLSIPVDLKEYWAKHGTNRYITIK 298
                            ****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.4E-1151298IPR010409GAGA-binding transcriptional activator
PfamPF062175.6E-916298IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MDYHKVPQWN AMPQYQIKEP NAFQMNAKLV MLCNERDDAI RERDRALTEK KSALDERDAA  60
MKQLDAAIME RDDAQRERDN AIAALQFHES TVNALLSGSA RGSKRTHHPT NHHPNSMQSA  120
QSMREECIHD ALPVSHVPHE APLSKKGTRA KTNKDPQMRS ARSPKKVKKI GEDLNRQVTT  180
DGSKAEWDAQ DLGSMNQIMF DESSMPVPVC SCTGVPRQCY KWGNGGWQSS CCTTSLSLYP  240
LPQMPNKRHA RMGGRKMSGS VFSRLLTRLA AAGQDLSIPV DLKEYWAKHG TNRYITIK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088547.11e-158PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
RefseqXP_011088549.11e-158PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
RefseqXP_011088550.11e-158PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
RefseqXP_011088551.11e-158PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
SwissprotQ8S8C61e-104BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A068TKY01e-139A0A068TKY0_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000041791e-133(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA92872128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.22e-98basic pentacysteine 4